Protein coding transcript 92007

• Transcript: Ll_transcript_451218
• CDS coordinates: 287-1066 (+)
• Peptide sequence: MDGVIYGAILAVCASNSKLLEAEYYFNQMKNESHSPNVYHYSSLLNAYSACGDYKKADRLIQDMKSEGLVPNKVILTTLLKVYVRGGLFEKSRKLLSELQSLGYAEDEMPYCLLMDGHAKAGQMDEAKLIFDEMMKSHVRSDGYAHSIMISSFCRAKRFGEAKELANDFEATFNKYDLVILNTMLCAFCRAGEMESVMETLKKMDELAISPDYNTFNILIKYFCKEKMYILAYRTMEDMHNKGYQPVEVCCLINTLILV*
• ORF Type: complete

Annotations of Ll_transcript_451218

• Blastp: Pentatricopeptide repeat-containing protein At1g10910, chloroplastic from Arabidopsis with 67.73% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g10910, chloroplastic from Arabidopsis with 67.03% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G10910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426096.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;