Transcript | Ll_transcript_451220 |
---|---|
CDS coordinates | 287-745 (+) |
Peptide sequence | MDGVIYGAILAVCASNSKLLEAEYYFNQMKNESHSPNVYHYSSLLNAYSACGDYKKADRLIQDMKSEGLVPNKVILTTLLKVYVRGGLFEKSRKLLSELQSLGYAEDEMPYCLLMDGHAKAGQMDEAKLIFDEMMKSHVRSGKTSFGFFFKI* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At1g10910, chloroplastic from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At1g10910, chloroplastic from Arabidopsis with 65.68% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT1G10910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426096.1) |
Pfam | Pentatricopeptide repeat domain (PF13812.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer