Protein coding transcript 92044

• Transcript: Ll_transcript_449342
• CDS coordinates: 463-939 (+)
• Peptide sequence: MKLLLKQQQRVLLGRSDVSGWGAFLKNSVAKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIGAGEELFYDYRYEPDRAPAWARKPEASGSKKDDGAPSNGRAKKLA*
• ORF Type: complete

Annotations of Ll_transcript_449342

• Blastp: Histone-lysine N-methyltransferase EZ1 from Zea with 91.77% of identity
• Blastx: Histone-lysine N-methyltransferase EZ1 from Zea with 92.34% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (541954)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014619327.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;