Transcript | Ll_transcript_340085 |
---|---|
CDS coordinates | 158-1006 (+) |
Peptide sequence | MEFGGSSSSFCLQHRVTPFTRTIGINNSGEWKRSSTKTGYSNIVRCCNSVSYKKFVNFALDQTTHHTLLLPSPLQEKYNSLNSKDGKGELSMLSFQAAKIRLLRSLIIESETMQVLDFTVFPKAEYDTPIFCANFFTTARTNIVVLDLNPLHDIINQGDYKKKYFKSLIPLGLKYAEHFPWGGKLTSESIKFFSPIVIWTKFTSSAQNYDILYSAFKDYYKVWLELVGSAVKETDESQILRNLQAQHRYLTWRAEKVIRICSISPHIQSYDWQIMLYRSCLL* |
ORF Type | complete |
Blastp | Phytochromobilin:ferredoxin oxidoreductase, chloroplastic from Arabidopsis with 56.67% of identity |
---|---|
Blastx | Phytochromobilin:ferredoxin oxidoreductase, chloroplastic from Arabidopsis with 56.67% of identity |
Eggnog | Catalyzes the two-electron reduction of the C2 and C3(1) diene system of 15,16-dihydrobiliverdin (By similarity)(ENOG41102EM) |
Kegg | Link to kegg annotations (AT3G09150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435724.1) |
Pfam | Ferredoxin-dependent bilin reductase (PF05996.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer