| Transcript | Ll_transcript_450874 |
|---|---|
| CDS coordinates | 2-589 (+) |
| Peptide sequence | ELEHALKLLHKALEIYNDAPGQQRKIAGIEAQIGVMYYTLEKYAESYNAFKNAISKLRAIGEKKSLFFGVVLNQTGLACVQCYALSEAAELFEEAGIIMEQEYGPYHPETLAVYSNLAGAYDALGRVDDAIENLEYIVSVREEKLGTANADVVDEMRRLNELLKENGRVRNRKFRSLEKLLDPKGHAINKLVRKA* |
| ORF Type | 5prime_partial |
| Blastp | Protein KINESIN LIGHT CHAIN-RELATED 3 from Arabidopsis with 65.93% of identity |
|---|---|
| Blastx | Protein KINESIN LIGHT CHAIN-RELATED 3 from Arabidopsis with 66.67% of identity |
| Eggnog | repeat-containing protein(COG0457) |
| Kegg | Link to kegg annotations (AT1G27500) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464053.1) |
| Pfam | Tetratricopeptide repeat (PF13424.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer