Protein coding transcript 92172

• Transcript: Ll_transcript_450339
• CDS coordinates: 30-731 (+)
• Peptide sequence: MAKASSGTVNPHGHSGVRIVVAGDQGTGKSSLIITAAAENFPINVPHILPPTRLPEDLYPDRVPITIIDTSSRSEDSDKVAEELQRADTVVLTYACDRPETLENLSTFWLPHLRKLEVKVPVIVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSASRHIQIPEVFYYAQKAVLHPTAPLFDQESQTLKPRCVRALKRIFILCDHDRDGALSDAELNDFQVVSPPFS*
• ORF Type: complete

Annotations of Ll_transcript_450339

• Blastp: Mitochondrial Rho GTPase 1 from Arabidopsis with 73.68% of identity
• Blastx: Mitochondrial Rho GTPase 1 from Arabidopsis with 73.68% of identity
• Eggnog: Mitochondrial GTPase involved in mitochondrial trafficking (By similarity)(ENOG410XRHW)
• Kegg: Link to kegg annotations (AT5G27540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428456.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;