Protein coding transcript 92193

• Transcript: Ll_transcript_449774
• CDS coordinates: 1-468 (+)
• Peptide sequence: CKCRKATKLYCFVHKVPVCGECICFPEHQICVIRTYSEWVIDGEYDWPPKCCKCQAVLEEGTGSQTTRLGCLHVIHTNCLVSHIKSFPPHTAPAGYVCPSCSTPIWPPKSVKDSGSRLHSKLKEAIIQTGVEKNLFGNHPVSLSVTESHGPPPAFA
• ORF Type: internal

Annotations of Ll_transcript_449774

• Blastp: Zinc finger protein-like 1 homolog from Caenorhabditis with 41.73% of identity
• Blastx: Zinc finger protein-like 1 homolog from Caenorhabditis with 41.73% of identity
• Eggnog: Zinc finger protein-like 1(ENOG410ZR2P)
• Kegg: Link to kegg annotations (CBG06644)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451406.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;