Protein coding transcript 92207

• Transcript: Ll_transcript_450695
• CDS coordinates: 58-807 (+)
• Peptide sequence: MWFCQLRSRLPFQTSLSHRFHRYFTDMASEGGNSFARRDRLREIEAKVQIWWEESDIFRSEPGDKPPEPGEKFFGNFPFPYMNGYLHLGHAFSLSKLEFAAAFHRLRGANVLLPFAFHCTGMPIKASADKLAREIQLFGNPPVFPGQSEVVVEEKNDDNSQNETAPDKFKGKKSKAAAKSGGQVYQWEIMRSVGISDSDIAKFQDPYEWLKFFPPLAAEDLKAFGLGCDWRRSFITTDLNPYYDSFVRL*
• ORF Type: complete

Annotations of Ll_transcript_450695

• Blastp: Leucine--tRNA ligase, cytoplasmic from Arabidopsis with 68.3% of identity
• Blastx: Leucine--tRNA ligase, cytoplasmic from Arabidopsis with 66.96% of identity
• Eggnog: Leucyl-trna synthetase(COG0495)
• Kegg: Link to kegg annotations (AT1G09620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423387.1)
• Pfam: tRNA synthetases class I (I, L, M and V) (PF00133.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;