Protein coding transcript 92222

• Transcript: Ll_transcript_448918
• CDS coordinates: 244-735 (+)
• Peptide sequence: MLVIISSILENNVITSFSIFFPLYPVHALNKLPYGKLDSKSIGVREGVVFMTYNSLIASSEKGRSRLQQLVQWCGAGFDGLVVFDECHKAKNLVPESGSQPTRTGEAVLDIQDRLPEARVVYCSATGASEPRNMGYMVRLGLWGAGTSFSEFREFLGALDRGGV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_448918

• Blastp: Protein FORGETTER 1 from Arabidopsis with 82.01% of identity
• Blastx: Protein FORGETTER 1 from Arabidopsis with 82.01% of identity
• Eggnog: Strawberry notch homolog(ENOG410XQ7Q)
• Kegg: Link to kegg annotations (AT1G79350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432321.1)
• Pfam: P-loop containing NTP hydrolase pore-1 (PF13872.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;