Transcript | Ll_transcript_448918 |
---|---|
CDS coordinates | 244-735 (+) |
Peptide sequence | MLVIISSILENNVITSFSIFFPLYPVHALNKLPYGKLDSKSIGVREGVVFMTYNSLIASSEKGRSRLQQLVQWCGAGFDGLVVFDECHKAKNLVPESGSQPTRTGEAVLDIQDRLPEARVVYCSATGASEPRNMGYMVRLGLWGAGTSFSEFREFLGALDRGGV |
ORF Type | 3prime_partial |
Blastp | Protein FORGETTER 1 from Arabidopsis with 82.01% of identity |
---|---|
Blastx | Protein FORGETTER 1 from Arabidopsis with 82.01% of identity |
Eggnog | Strawberry notch homolog(ENOG410XQ7Q) |
Kegg | Link to kegg annotations (AT1G79350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432321.1) |
Pfam | P-loop containing NTP hydrolase pore-1 (PF13872.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer