Protein coding transcript 92226

• Transcript: Ll_transcript_451490
• CDS coordinates: 704-1222 (+)
• Peptide sequence: MFLQHEEIISSCFLLFVYCVAVSLTLHNNNNFIVFYAQKYIADFYISDFQSGLRALVKAGYSAKVAPFVEPTTVVDVTKGNKELSPNFLGWLADRKLSTDDRIMRLKEGYIKEGSTVSVIGVVRRHDNVVMIVPSSEPVSTGCQWFRCLLPTYVEGLVMTCEDNQNSDVIPV*
• ORF Type: complete

Annotations of Ll_transcript_451490

• Blastp: Uncharacterized membrane protein At1g16860 from Arabidopsis with 58.9% of identity
• Blastx: Uncharacterized membrane protein At1g16860 from Arabidopsis with 58.9% of identity
• Eggnog: NA(ENOG410ZNXM)
• Kegg: Link to kegg annotations (AT1G16860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418921.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;