Transcript | Ll_transcript_451481 |
---|---|
CDS coordinates | 201-986 (+) |
Peptide sequence | MGTRIPTHQLSSGLYLSGRPEQPKERQPTMSSRSAPYTGGDPTKSGELGKMLEIPAVDPNPTTKPSQNTGSVRSRPNSGPTIKHSGLGPLSRKSSGSGQMALPTGLFTSGPIGSGPVDISGGDGRRSGNLDRSGSMGKMVYGSGVTSLSEEVNVGFRVSRAVVWVFLVVVAMGLLVGVFLMVAVKKAVILVALGAVIVPVVVLFIWNCVWGRRGLLGFLKRYPDAELRGAIDGQYIKVTGVVTCGSIPLESSYQRVPRCVYA |
ORF Type | 3prime_partial |
Blastp | Uncharacterized membrane protein At1g16860 from Arabidopsis with 44.01% of identity |
---|---|
Blastx | Uncharacterized membrane protein At1g16860 from Arabidopsis with 43.04% of identity |
Eggnog | NA(ENOG410ZNXM) |
Kegg | Link to kegg annotations (AT1G16860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418921.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer