Protein coding transcript 92244

• Transcript: Ll_transcript_451170
• CDS coordinates: 158-790 (+)
• Peptide sequence: MSKQTKTSIEESRKKIFLLDSKGLIVSSRKNSLQHFKKPWAHEHEPVNTLLEAVKIIKPTVLIGASGVGKTFTKEVIEAITSNNEKPFILALSNPTSQSECTAEEAYQWSEGRAIFASGSPFDPVEYNGKVYYSGQANNAYIFPGFGLGLVISGATRVHDDMLLAASESLAKQVTDENYAKGLTYPPFTDIRKISANIAANVAVKAYELGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_451170

• Blastp: NADP-dependent malic enzyme from Vitis with 81.52% of identity
• Blastx: NADP-dependent malic enzyme from Vitis with 80.87% of identity
• Eggnog: malic enzyme(COG0281)
• Kegg: Link to kegg annotations (100233140)
• CantataDB: Link to cantataDB annotations (CNT0000733)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435082.1)
• Pfam: Malic enzyme, NAD binding domain (PF03949.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;