Protein coding transcript 92429

• Transcript: Ll_transcript_449864
• CDS coordinates: 3-518 (+)
• Peptide sequence: RLPENLCYYGKLLNLTTYDNNLSGELPESLENCSSLLEIKIYNNQFSGNIPSGLWKSSNLLNFMVRQNKFTGELPDRLSSTISRFEISYNQFSGRIPAGVYSLKNVVVFNASKNFLNGSFPQELATLSKLTTLLLDQNHLTGSIPSDIIAWKSLVTLNLSQNQLSGQIPDTI
• ORF Type: internal

Annotations of Ll_transcript_449864

• Blastp: Receptor-like protein kinase HSL1 from Arabidopsis with 38.73% of identity
• Blastx: Receptor protein-tyrosine kinase CEPR1 from Arabidopsis with 37.36% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G28440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448353.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;