Protein coding transcript 92433

• Transcript: Ll_transcript_449853
• CDS coordinates: 515-964 (+)
• Peptide sequence: MTLQLTEKSDVYSFGVLMLELVTARRPIEQGKYIVREVMGVMDTSKDLYNLHSILDPTIIKGAKPKGLEKFVELALSCVNEYGHERPSMADVVKEVENIIELVGLNPNSESATTSEGYDVEKGGDIIHPYVKEDFNYSGSVPSVKVEPQ*
• ORF Type: complete

Annotations of Ll_transcript_449853

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 51.37% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 53.21% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G49770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440217.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;