Transcript | Ll_transcript_444838 |
---|---|
CDS coordinates | 96-476 (+) |
Peptide sequence | MPRGTLEVILVSAKDLPNADFLKKMDPYVVLTYRSQEHTSSVAEGAGSDPIWNESFLFTVSDNVSELKLRFMDKDTFSDDDYLGETNIFLEPVFYEKSIAETVYNVVKEDKYSGEVKVALHFHPEW* |
ORF Type | complete |
Blastp | Elicitor-responsive protein 3 from Oryza sativa with 58.4% of identity |
---|---|
Blastx | Elicitor-responsive protein 3 from Oryza sativa with 58.4% of identity |
Eggnog | Domain-Containing protein(COG5038) |
Kegg | Link to kegg annotations (4336487) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460866.1) |
Pfam | C2 domain (PF00168.29) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer