Transcript | Ll_transcript_448953 |
---|---|
CDS coordinates | 1571-1993 (+) |
Peptide sequence | MVDPWEANQSTYQRTLTVLSRVQSSICETGLVSRESLKVMLVCGSDLLQSFGIPGFWIRDQVKAISRDYGVVCISREGQDVGIIISSDDILNENQVYQTCLTCLIYLFVFNVCIHISWTSSNFYVLIFDMYLITLGSYIG* |
ORF Type | complete |
Blastp | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 65.96% of identity |
---|---|
Blastx | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 63.25% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G55810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421187.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer