Protein coding transcript 92536

• Transcript: Ll_transcript_448967
• CDS coordinates: 1096-1401 (+)
• Peptide sequence: MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGNIFSIFVIAIAAAEAAIGLAIVSSISRNRKSTRINQSNLLNK*
• ORF Type: complete

Annotations of Ll_transcript_448967

• Blastp: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic from Morus with 98.02% of identity
• Blastx: NAD(P)H-quinone oxidoreductase chain 4, chloroplastic from Soja with 88.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001954)
• Mirbase: osa-MIR5079b (MI0026007)
• Ncbi protein: Link to NCBI protein (YP_008963654.1)
• Pfam: NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420.23)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;