Protein coding transcript 92544

• Transcript: Ll_transcript_449645
• CDS coordinates: 84-638 (+)
• Peptide sequence: MLARLAGNRFNQIRHVFHQPSRTFSTALNYHLDSPDNKPDLPWEYSDANKTKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNAVAKVVEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCMIRGSRGIEEALLKHLGVKRNEVTQDGLFSVGEMECMVSLFFEQDVALISALS*
• ORF Type: complete

Annotations of Ll_transcript_449645

• Blastp: NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial from Arabidopsis with 84.88% of identity
• Blastx: NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial from Arabidopsis with 84.88% of identity
• Eggnog: Nadh dehydrogenase(COG1905)
• Kegg: Link to kegg annotations (AT4G02580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436344.1)
• Pfam: Thioredoxin-like [2Fe-2S] ferredoxin (PF01257.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;