Transcript | Ll_transcript_451114 |
---|---|
CDS coordinates | 150-473 (+) |
Peptide sequence | MEDALDHSTSLCTHCDRAIPDANIDLHYAHCSRNLEKCKICGDMVPKRHADDHYLSTHAPVCETLSLLLFPFQGLMSYKVASSDKPVMFALLKDKETVKDERGYFNF* |
ORF Type | complete |
Blastp | TRAF-type zinc finger domain-containing protein 1 from Macaca with 37.5% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (101867217) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001242241.2) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer