Protein coding transcript 92695

• Transcript: Ll_transcript_449111
• CDS coordinates: 691-1092 (+)
• Peptide sequence: MGFGVFGSFVVLTLLFKHLASQQPNTDEFFVSEFLHKMGFYNFTASICSWERVSCDADREYVFELNFSGIGLTGPIPDTTIGKLSKLQSLDLSFNKITALPSDFWGLSSLKTLNLSSNQISDSLNNIGNFGLLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_449111

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At2g24230 from Arabidopsis with 57.14% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At2g24230 from Arabidopsis with 57.14% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT2G24230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441539.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;