Transcript | Ll_transcript_449302 |
---|---|
CDS coordinates | 2-541 (+) |
Peptide sequence | RKCERNTRIRMDVTNVLHMNRGIGKSSYANNSLLQQKAISLTKHIREEAITSLYRSMLPRCLSIAELGCASGPSAFIAVSEIIKIVEKLCREMNHKSPDYKVLMNDLPGNDFNNIFKSISSFKEKLSNELESQIGPCYFYGVPASFYGRIFPNQTLHFVHSSYSLQWLSKVNSFSYIFN* |
ORF Type | 5prime_partial |
Blastp | Salicylate carboxymethyltransferase from Clarkia with 53.37% of identity |
---|---|
Blastx | Salicylate carboxymethyltransferase from Clarkia with 53.37% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAF00108) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455257.1) |
Pfam | SAM dependent carboxyl methyltransferase (PF03492.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer