Protein coding transcript 92718

• Transcript: Ll_transcript_449308
• CDS coordinates: 3-467 (+)
• Peptide sequence: SSYAKNSSLQQKSLSLTKHIRKEAITSLYRSMLPRCLSIAELGCASGPNAFIAVSEIIKIVEKLCREMNHKSPDYKVLMNDLPGNDFNNIFKSISSFKEKLSNELESQIGPCYFYGVPASFYGRIFPNQTLHFVHSSYSLQWLSKVNSFSYIFN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_449308

• Blastp: Salicylate carboxymethyltransferase from Clarkia with 52.03% of identity
• Blastx: Salicylate carboxymethyltransferase from Clarkia with 52.03% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAF00108)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455257.1)
• Pfam: SAM dependent carboxyl methyltransferase (PF03492.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;