Protein coding transcript 92734

• Transcript: Ll_transcript_451472
• CDS coordinates: 235-867 (+)
• Peptide sequence: MERVQSNGQWSLFCPNEAPGLADCWGEEFEKLYVQYEREGKAKKVVEAQNLWFEILKSQMETGTPYMLFKDSCNRKSNQQNLGTIKSSNLCTEIIEYTSPTETAVCNLASIALPRHVKDKGVPMESHPSKLVGSRGSKSRYFDFDKLGEVTATVTTNLNKIIDVNYYPVDNARRSNLRHRPIGIGVQGLADTFILLGMAFDSPEAEQLNKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_451472

• Blastp: Ribonucleoside-diphosphate reductase large subunit from Arabidopsis with 84.83% of identity
• Blastx: Ribonucleoside-diphosphate reductase large subunit from Arabidopsis with 85.94% of identity
• Eggnog: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides (By similarity)(COG0209)
• Kegg: Link to kegg annotations (AT2G21790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462638.1)
• Pfam: Ribonucleotide reductase, barrel domain (PF02867.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;