Transcript | Ll_transcript_449819 |
---|---|
CDS coordinates | 183-587 (+) |
Peptide sequence | MIKLFKVKEKQRELAENAGGGPPIKKQSAGELCVHKDISELNLPKSCTIQFPNGKDDLMNFEVTIRPDDGYYLGGTFLFSFQVSLIYPHEAPKVKCKTKEPNYEDPLNHDVAAVLRDNPKLFESNVRRAMAGGYV |
ORF Type | 3prime_partial |
Blastp | NEDD8-conjugating enzyme Ubc12 from Arabidopsis with 63.43% of identity |
---|---|
Blastx | NEDD8-conjugating enzyme Ubc12 from Arabidopsis with 63.43% of identity |
Eggnog | ubiquitin-conjugating enzyme(ENOG410XS81) |
Kegg | Link to kegg annotations (AT4G36800) |
CantataDB | Link to cantataDB annotations (CNT0002643) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_006590677.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer