Protein coding transcript 92793

• Transcript: Ll_transcript_449574
• CDS coordinates: 181-507 (+)
• Peptide sequence: MVKRQKTAFPPNFVHSLDGSHMMMTAVACKKEGLNFAGVHDSYWTHAGDVDQMNRILREKFVELYETPVLENLVEGFQRSFPKLSFPPLPERGDFDLREVLESPYFFN*
• ORF Type: complete

Annotations of Ll_transcript_449574

• Blastp: DNA-directed RNA polymerase 1A from Nicotiana with 86.11% of identity
• Blastx: DNA-directed RNA polymerase 1A from Nicotiana with 86.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420030.1)
• Pfam: DNA-dependent RNA polymerase (PF00940.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;