Protein coding transcript 92836

• Transcript: Ll_transcript_450303
• CDS coordinates: 133-648 (+)
• Peptide sequence: MASTSSLTLSQSLLFPKPTSLKPSSYSLSLPTNNGFSSKSSLSSSSLRRRPITASAAPTTEPTTTLVDKSVNSIRFLSIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPKWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKVSEELWNFVLVMNSLRVIGFCIQL*
• ORF Type: complete

Annotations of Ll_transcript_450303

• Blastp: Transketolase-2, chloroplastic from Arabidopsis with 62.94% of identity
• Blastx: Transketolase, chloroplastic from Solanum with 92.68% of identity
• Eggnog: Transketolase(COG0021)
• Kegg: Link to kegg annotations (AT2G45290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460699.1)
• Pfam: Transketolase, thiamine diphosphate binding domain (PF00456.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;