Protein coding transcript 92844

• Transcript: Ll_transcript_450295
• CDS coordinates: 82-630 (+)
• Peptide sequence: MVFNEIRVTILRHWSRHTPEGAALEAEWNAKFAEYEKKYKEEAAELKSLINGELPAGWEKALPTYTPEIPGDATRNLSQHNLNALAKVLPGLLGGSADLASSNMTLLKMFGNFQKDTPAERNIRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAIRLSALSQAGVIYVMTHDSI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_450295

• Blastp: Transketolase, chloroplastic from Solanum with 88.51% of identity
• Blastx: Transketolase, chloroplastic from Solanum with 88.51% of identity
• Eggnog: Transketolase(COG0021)
• Kegg: Link to kegg annotations (102591899)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003521870.1)
• Pfam: Transketolase, thiamine diphosphate binding domain (PF00456.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;