Protein coding transcript 9288

• Transcript: Ll_transcript_340336
• CDS coordinates: 346-894 (+)
• Peptide sequence: MGLTISRLFRLLYAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERISEARDELHRMLSEGELHDATLLVFANKQDLPNALSVTEITDKLGLNSFRHRRWYIQATCATSGQGLYEGLDWLSSNISSKAK*
• ORF Type: complete

Annotations of Ll_transcript_340336

• Blastp: ADP-ribosylation factor 1 from Oryza sativa with 86.19% of identity
• Blastx: ADP-ribosylation factor 1 from Oryza sativa with 86.19% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (4327591)
• CantataDB: Link to cantataDB annotations (CNT0000094)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422635.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;