Protein coding transcript 92938

• Transcript: Ll_transcript_450814
• CDS coordinates: 294-992 (+)
• Peptide sequence: MQNDLFPQHLSFPSISGLFPVNSYRVSPVPSSDITKEYSGAVHDGSKPCGCFGRDSIANAAAKVGPAVVNIVVPQDFHGITAGKGIGSGTIINKDGTILTCAHVVVDFQGTRISSRRKVEVTLQDGRTFVGKVIHADQHSDIAIVKINSETPLPEAKLGSSSRLRPGDWVIAMGCPLSLQNTVTAGIVRCKEEKNPSYYSRHLLESIYKQIVQLIWEILEGLWSTLMGRLLV*
• ORF Type: complete

Annotations of Ll_transcript_450814

• Blastp: Putative protease Do-like 14 from Arabidopsis with 64.92% of identity
• Blastx: Putative protease Do-like 14 from Arabidopsis with 72.78% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT5G27660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418964.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;