Protein coding transcript 92960

• Transcript: Ll_transcript_450001
• CDS coordinates: 151-1212 (+)
• Peptide sequence: MCGRARCSLRADDIPRACHRTLPHPPSLHMDRYRPSYNVSPGFDMPVIRREDSSNSEGCVLHCMKWGLIPSFTKKTEKPDHYKMFNARSESIDEKASFRRLIPKNRCLVAVEGFYEWKKDGSKKQPYYIHFKDGRPLVFAALYDSWQNSAGETLCTFTIVTTSSSSAFQWLHDRMPVILGDKDSTDTWLGSSASGYKNVLKPYEASDLVWYPVTPSMGKPSFDGPECIKEIQLKAEGNTSISKFFSRKGAESGDVRQEKKLSSYEIIETELPKDPSEEAKAEKVENDLKSSACPHSQDATKVPVKRDYDMFSADSKPDWTNNDKVRSNPIKKKEKGKAGDDKQATLFSYFGKR*
• ORF Type: complete

Annotations of Ll_transcript_450001

• Blastp: Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein from Silurana with 34.55% of identity
• Blastx: Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein from Silurana with 34.55% of identity
• Eggnog: conserved protein(COG2135)
• Kegg: Link to kegg annotations (394754)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450068.1)
• Pfam: SOS response associated peptidase (SRAP) (PF02586.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;