Transcript | Ll_transcript_450001 |
---|---|
CDS coordinates | 151-1212 (+) |
Peptide sequence | MCGRARCSLRADDIPRACHRTLPHPPSLHMDRYRPSYNVSPGFDMPVIRREDSSNSEGCVLHCMKWGLIPSFTKKTEKPDHYKMFNARSESIDEKASFRRLIPKNRCLVAVEGFYEWKKDGSKKQPYYIHFKDGRPLVFAALYDSWQNSAGETLCTFTIVTTSSSSAFQWLHDRMPVILGDKDSTDTWLGSSASGYKNVLKPYEASDLVWYPVTPSMGKPSFDGPECIKEIQLKAEGNTSISKFFSRKGAESGDVRQEKKLSSYEIIETELPKDPSEEAKAEKVENDLKSSACPHSQDATKVPVKRDYDMFSADSKPDWTNNDKVRSNPIKKKEKGKAGDDKQATLFSYFGKR* |
ORF Type | complete |
Blastp | Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein from Silurana with 34.55% of identity |
---|---|
Blastx | Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein from Silurana with 34.55% of identity |
Eggnog | conserved protein(COG2135) |
Kegg | Link to kegg annotations (394754) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450068.1) |
Pfam | SOS response associated peptidase (SRAP) (PF02586.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer