Protein coding transcript 92984

• Transcript: Ll_transcript_450027
• CDS coordinates: 36-1286 (+)
• Peptide sequence: MRTLTLKMDQIHIPIFSYHFHLFVFSLLLSFDNHIHIFHNNNNTSSQFHSSSSIVTLQDSFLNHPFLFSHKSRRFYHRHHHHHHRSFTFETNSLQYDFYHDSCPRAERIVRAAIRELHRSRPSLIPAIIRLAFHDCFIQGCDASVLLDADDYIDSEKESPPNQSLKGFDVIETIKSKLEEACPGVVSCADILVLAARDCVALNHVFQAGGPFYPLNTGRRDGSNSFSDIATFELPSPYGDLSEIIASFKTRGFNEREMVTLLGSHSIGVIHCKFFQDRLYNFAGTNEPDPSLDTEFLKLLRSRCNHTNALSSATLGHNSHGSPSSLVEEPGVDMDFEQTRPDFGTVYYHSLLQGRGVLYSDQQLMKGKTTKKWIKAYAYDPTLFHRDFALVMMKLSDLRVLTFPMGQIRCKCSKIA*
• ORF Type: complete

Annotations of Ll_transcript_450027

• Blastp: Putative Peroxidase 48 from Arabidopsis with 51.34% of identity
• Blastx: Putative Peroxidase 48 from Arabidopsis with 51.34% of identity
• Eggnog: peroxidase(ENOG410YD1D)
• Kegg: Link to kegg annotations (AT4G33870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443434.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;