Protein coding transcript 93141

• Transcript: Ll_transcript_377147
• CDS coordinates: 125-670 (+)
• Peptide sequence: MSGEVVFDGQDAGYVPENIDYPQNHSDEHDEGNVIDDESGFPQLQPDEHDAEILAEEEADPLENEFDGHGVEELPGNTDSLPQEHTVTEEEHHDGGDVTENFTSQEVQGPEGDSKPSEIKKWPGWPGENVFRMLVPVQKVGSIIGRKGEFIKKITEETKARIKILDGPPGTTERAVVSKYE*
• ORF Type: complete

Annotations of Ll_transcript_377147

• Blastp: Flowering locus K homology domain from Arabidopsis with 69.14% of identity
• Blastx: Flowering locus K homology domain from Arabidopsis with 69.14% of identity
• Eggnog: mRNA transport(ENOG410XNN8)
• Kegg: Link to kegg annotations (AT3G04610)
• CantataDB: Link to cantataDB annotations (CNT0002412)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441915.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;