Transcript | Ll_transcript_378290 |
---|---|
CDS coordinates | 3-383 (+) |
Peptide sequence | TLQEQERAYMMLRMNNDGSDYGSWEGGSYLHEGDFNDLDDAIDEDEDDDNDDNEDVEGYEDEDVFYVHAHGTGGEHDSPRVEFDPAVFTSDEAYARALQEAEEREMAARLFALAGISDRKFSTLST* |
ORF Type | 5prime_partial |
Blastp | E3 ubiquitin ligase BIG BROTHER-related from Arabidopsis with 51.61% of identity |
---|---|
Blastx | E3 ubiquitin ligase BIG BROTHER-related from Arabidopsis with 75.47% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT3G19910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441685.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer