Protein coding transcript 93158

• Transcript: Ll_transcript_378290
• CDS coordinates: 3-383 (+)
• Peptide sequence: TLQEQERAYMMLRMNNDGSDYGSWEGGSYLHEGDFNDLDDAIDEDEDDDNDDNEDVEGYEDEDVFYVHAHGTGGEHDSPRVEFDPAVFTSDEAYARALQEAEEREMAARLFALAGISDRKFSTLST*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_378290

• Blastp: E3 ubiquitin ligase BIG BROTHER-related from Arabidopsis with 51.61% of identity
• Blastx: E3 ubiquitin ligase BIG BROTHER-related from Arabidopsis with 75.47% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G19910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441685.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;