Protein coding transcript 93206

• Transcript: Ll_transcript_377290
• CDS coordinates: 533-1012 (+)
• Peptide sequence: MDTDYLSRLTHALTTVRHVNKTDVVTLGTTFGSLSHVMGASMEDLARCPGIGERKVKRLWDTFHEPFKRVESSRQPIPETSVQNNPASLDTSIRNNAESSSVNEEKQKDVEDVSKRRKKEPELSVKSALSVAFAKYSNRVGKRNSTSQVKGNGEQEAET*
• ORF Type: complete

Annotations of Ll_transcript_377290

• Blastp: DNA excision repair protein ERCC-1 from Arabidopsis with 59.44% of identity
• Blastx: DNA excision repair protein ERCC-1 from Arabidopsis with 63.73% of identity
• Eggnog: Excision repair cross-complementing rodent repair deficiency, complementation group 1 (Includes overlapping antisense sequence)(COG5241)
• Kegg: Link to kegg annotations (AT3G05210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427809.1)
• Pfam: Helix-hairpin-helix domain (PF14520.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;