Protein coding transcript 93211

• Transcript: Ll_transcript_377295
• CDS coordinates: 368-712 (+)
• Peptide sequence: MNILYTFCYQVKRLWDTFHEPFKRVESSRQPIPETSVQNNPASLDTSIRNNAESSSVNEEKQKDVEDVSKRRKKEPELSVKSALSVAFAKYSNRVGKRNSTSQVKGNGEQEAET*
• ORF Type: complete

Annotations of Ll_transcript_377295

• Blastp: DNA excision repair protein ERCC-1 from Arabidopsis with 45.45% of identity
• Blastx: DNA excision repair protein ERCC-1 from Arabidopsis with 79.17% of identity
• Eggnog: Excision repair cross-complementing rodent repair deficiency, complementation group 1 (Includes overlapping antisense sequence)(COG5241)
• Kegg: Link to kegg annotations (AT3G05210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427809.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;