Transcript | Ll_transcript_377585 |
---|---|
CDS coordinates | 70-990 (+) |
Peptide sequence | MYRAAANRLFSGARCYCHNSRLRLRPLQISIASSRFSTTETQPFTNPHITINPIPNTSTIENPNSSDSTSSPSSSTEADDAPRYENPRARAEYQDEKSRVLQASLPYVIKLGWTETALIAGARAVGLSPSIIGSLSRKEAALVEFFMDDCLRRLINRIDSDESLKNLTPSDCISKLIRIRLEMQSPYISKWPQALSIQAQPINVPTSFKQRAMLVDEIWHAADDNTSNIDWYAKRTVLGGIYSTTEIYMLTDSSPDFRNTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSFQGFVGKVFGR* |
ORF Type | complete |
Blastp | Ubiquinone biosynthesis protein COQ9, mitochondrial from Silurana with 36.14% of identity |
---|---|
Blastx | Ubiquinone biosynthesis protein COQ9, mitochondrial from Silurana with 36.14% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (496601) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443403.1) |
Pfam | COQ9 (PF08511.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer