Protein coding transcript 93288

• Transcript: Ll_transcript_379153
• CDS coordinates: 504-1361 (+)
• Peptide sequence: MVAKSLCWNKLEEKGDIAIWQKPKNHLDCKANRKISQKRPFCQAQSNPDKAWYTDMQTCLSPLPEVSSKEETSGGALENWPKRVKATPPRIYKETIKGVTPETFKNDNKLWKKRISYYKNVNNQLGQAGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVQAKVNTLGAIYERGLIGTYHDWCEAMSTYPRTYDLIHADSLFSLYSHSCELENILLEMDRVLRPEGSVIIRDDVDILVKVKSITNGMDWDSQIVDHEDGPLEREKLLFAVKKYWTAPASSEQDS*
• ORF Type: complete

Annotations of Ll_transcript_379153

• Blastp: Probable methyltransferase PMT16 from Arabidopsis with 63.03% of identity
• Blastx: Probable methyltransferase PMT16 from Arabidopsis with 64.97% of identity
• Eggnog: Methyltransferase(ENOG410YAWV)
• Kegg: Link to kegg annotations (AT2G45750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449623.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;