Protein coding transcript 93323

• Transcript: Ll_transcript_378873
• CDS coordinates: 174-791 (+)
• Peptide sequence: MGICFSTTKVSGSNSNNNTTTAAAAAGAVTTATANPNRKWSSNTQSDLTTTVVSIQKQQQPLTTGQRQKVKEESHSQIHRTKEKASSKRQSGHVPCGKRTNFGYEKDFDRRFSLGKLLGHGQFGYTYVGIDKVNGDRVAVKRLEKNKMVFPIAVEDVKREVKILKQLTGHENVVQFYNAFEDDSYVYIVMELCEGGELLDRILSK*
• ORF Type: complete

Annotations of Ll_transcript_378873

• Blastp: Calcium-dependent protein kinase 28 from Arabidopsis with 54.15% of identity
• Blastx: Calcium-dependent protein kinase 28 from Arabidopsis with 68.53% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT5G66210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424168.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;