Protein coding transcript 93334

• Transcript: Ll_transcript_378861
• CDS coordinates: 1025-1864 (+)
• Peptide sequence: MLKVAAECHLHGLVHRDMKPENFLFRSSKDDSSLKATDFGLSDFIKPGRRFTDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLSGRRPFWDKTEDGIFKEVIRNKPDFRRKPWPTISNAAKDFVKKMLVKDPRARLTAAQALSHPWVKEGGEALEIPIDISVLGNMRQFVKYSRLKQFALRALASTINEEELSDLKDQFDAIDVDKNGVISLEEMRQALAKDLPWKLKESRVLEILQAVSIFAPLQAPHCSVGHLFQFLKFERNEGSLVFVGFLL*
• ORF Type: complete

Annotations of Ll_transcript_378861

• Blastp: Calcium-dependent protein kinase 16 from Arabidopsis with 87.24% of identity
• Blastx: Calcium-dependent protein kinase 16 from Arabidopsis with 86.64% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT2G17890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424168.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;