Protein coding transcript 93336

• Transcript: Ll_transcript_378863
• CDS coordinates: 1505-1942 (+)
• Peptide sequence: MRQFVKYSRLKQFALRALASTLNEEELSDLKDQFDAIDVDKNGAISLEEMRQALAKDLPWKLKESRVLEILQAIDSNTDGLVDFTEFVAAALHVHQLEEHDSEKWQERSQAAFEKFDLDKDGYITADELRVVGLMPLLILPTYFI*
• ORF Type: complete

Annotations of Ll_transcript_378863

• Blastp: Calcium-dependent protein kinase 28 from Arabidopsis with 88.55% of identity
• Blastx: Calcium-dependent protein kinase 18 from Oryza sativa with 93.1% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT5G66210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444836.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;