Protein coding transcript 93377

• Transcript: Ll_transcript_378473
• CDS coordinates: 411-986 (+)
• Peptide sequence: MKIQCDVCEKAPATVICCADEAALCAKCDVEVHAANRLASKHQRLLLQCLSNKLPRCDICQDKAAFIFCVEDRALFCKDCDEPIHSAGSLSSNHQRFLATGIRVALSSKCTEDDEKSHSEPSNSSVQLAHVKTPQQVPSFTSSWAVDDILELTDFESPGKVRQLYFTISSIMLIKLRYSTLLHLFWFFIDI*
• ORF Type: complete

Annotations of Ll_transcript_378473

• Blastp: B-box zinc finger protein 24 from Arabidopsis with 61.63% of identity
• Blastx: B-box zinc finger protein 24 from Arabidopsis with 61.63% of identity
• Eggnog: nucleic acid binding transcription factor activity(ENOG410YBMW)
• Kegg: Link to kegg annotations (AT1G06040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448580.1)
• Pfam: B-box zinc finger (PF00643.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;