Protein coding transcript 93378

• Transcript: Ll_transcript_378476
• CDS coordinates: 1248-1676 (+)
• Peptide sequence: MIVHFVPSFRLQDKAAFIFCVEDRALFCKDCDEPIHSAGSLSSNHQRFLATGIRVALSSKCTEDDEKSHSEPSNSSVQLAHVKTPQQVPSFTSSWAVDDILELTDFESPGKVRQLYFTISSIMLIKLRYSTLLHLFWFFIDI*
• ORF Type: complete

Annotations of Ll_transcript_378476

• Blastp: B-box zinc finger protein 24 from Arabidopsis with 50% of identity
• Blastx: B-box zinc finger protein 24 from Arabidopsis with 83.61% of identity
• Eggnog: nucleic acid binding transcription factor activity(ENOG410YBMW)
• Kegg: Link to kegg annotations (AT1G06040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;