Transcript | Ll_transcript_378478 |
---|---|
CDS coordinates | 1248-1814 (+) |
Peptide sequence | MIVHFVPSFRLQDKAAFIFCVEDRALFCKDCDEPIHSAGSLSSNHQRFLATGIRVALSSKCTEDDEKSHSEPSNSSVQLAHVKTPQQVPSFTSSWAVDDILELTDFESPGKKGSLEFGELEWLADEGLFDEQFPPEALAAAEVPQIPVMHTSSVTSYKASKSSMSYKKPRIEVLDEDDNEHCTVPDLG* |
ORF Type | complete |
Blastp | B-box zinc finger protein 24 from Arabidopsis with 51.06% of identity |
---|---|
Blastx | B-box zinc finger protein 24 from Arabidopsis with 48.31% of identity |
Eggnog | nucleic acid binding transcription factor activity(ENOG410YBMW) |
Kegg | Link to kegg annotations (AT1G06040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448579.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer