Protein coding transcript 93379

• Transcript: Ll_transcript_378478
• CDS coordinates: 1248-1814 (+)
• Peptide sequence: MIVHFVPSFRLQDKAAFIFCVEDRALFCKDCDEPIHSAGSLSSNHQRFLATGIRVALSSKCTEDDEKSHSEPSNSSVQLAHVKTPQQVPSFTSSWAVDDILELTDFESPGKKGSLEFGELEWLADEGLFDEQFPPEALAAAEVPQIPVMHTSSVTSYKASKSSMSYKKPRIEVLDEDDNEHCTVPDLG*
• ORF Type: complete

Annotations of Ll_transcript_378478

• Blastp: B-box zinc finger protein 24 from Arabidopsis with 51.06% of identity
• Blastx: B-box zinc finger protein 24 from Arabidopsis with 48.31% of identity
• Eggnog: nucleic acid binding transcription factor activity(ENOG410YBMW)
• Kegg: Link to kegg annotations (AT1G06040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448579.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;