Transcript | Ll_transcript_378020 |
---|---|
CDS coordinates | 117-707 (+) |
Peptide sequence | MSHDRSFSVNPSDYQLLEEVGYGATATVYRANFLPLNQLVAIKSLDLDRCTINLDDIRRETQTMSLIDHPNVVRAFCSFTVDHSLWVVMPFMNEGSCLHLMKSAYPDGFEEDVIGSILKETLKALEYLHQQGHIHRDVKAGNILLDSSGTIKLGDFGVSTCMFDSCDRQRSRNTFVGTPCWMAPEVLQPGSGYNSK* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase BLUS1 from Arabidopsis with 47.47% of identity |
---|---|
Blastx | Serine/threonine-protein kinase BLUS1 from Arabidopsis with 47.47% of identity |
Eggnog | ste20-related kinase adaptor(ENOG410XSWS) |
Kegg | Link to kegg annotations (AT4G14480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438728.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer