Transcript | Ll_transcript_377442 |
---|---|
CDS coordinates | 1065-1379 (+) |
Peptide sequence | MVIQTKSHSDEEVIAKIKILVMKPDALRHGISASDAARTLGVAPAMAKKHLLSAESKGVLCRDISPDGFRFYINLFLEFDRDDMYLVKDQGLYASWVRANHARG* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 36 from Arabidopsis with 62% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 36 from Arabidopsis with 67.9% of identity |
Eggnog | vacuolar protein sorting(ENOG410XR74) |
Kegg | Link to kegg annotations (AT5G04920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453473.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer