Protein coding transcript 93542

• Transcript: Ll_transcript_377469
• CDS coordinates: 2-580 (+)
• Peptide sequence: STTIGDEEIGSREEMQELLLSVGIISPVTKESAGALYHQQLSRQLADFVKVPLERAGGIINLIDIYCLFNRARGTELISPDDLLQACSLWEKFDVPVVLRKFDSGVMVIQTKSHSDEQVISKIKILATKPDALRSGISASDAAKTLGVAPAMAKEHLMSAESKGVLCRDISPDGFRFYINLFLEFDRDDKYS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_377469

• Blastp: Vacuolar protein sorting-associated protein 36 from Arabidopsis with 76.8% of identity
• Blastx: Vacuolar protein sorting-associated protein 36 from Arabidopsis with 76.8% of identity
• Eggnog: vacuolar protein sorting(ENOG410XR74)
• Kegg: Link to kegg annotations (AT5G04920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449356.1)
• Pfam: EAP30/Vps36 family (PF04157.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;