Protein coding transcript 93586

• Transcript: Ll_transcript_378258
• CDS coordinates: 61-405 (+)
• Peptide sequence: MKVRKYLFPPIDSTSKGPHTSLNTSSRGFFDLVGRLESKEFLDNLLDKQSSHSVVGAFIHGNPATYSFLLSNSKLLKFKCPYLKCQSQVSWSVSALRHVCSPTWILILKVLFAD*
• ORF Type: complete

Annotations of Ll_transcript_378258

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 27.5% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465092.1)
• Pfam: gag-polypeptide of LTR copia-type (PF14223.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;