Protein coding transcript 93605

• Transcript: Ll_transcript_377185
• CDS coordinates: 845-1813 (+)
• Peptide sequence: MAPDALLDFQDMQRRISVIEMTVKQINGSLVPKDEIREETENQHTPTNEIEVLPKDIMLDQISECSSYGISRRGTLEADDKMLELWETADKDGIIELTQNKAQRGVTNERKNKYPSSESLMEKELSVDKLEISRRLTQPHEVGNKSKVLERLDSDAQKLTNLQITIQDLMKKVEITETGKKGKSIEYNSAKDQLKATQETITKFLDANHELKKNVEDSSMPSGERGVVESGEIGSVSRRVTEYAQRGSEKIGQLQLEVQRLQFLFLKLNGGKESKGKAKVADHRSPRVLLRDYLYGGTRTNKQKKKKTPCLFACVRTLTKGD*
• ORF Type: complete

Annotations of Ll_transcript_377185

• Blastp: Protein NETWORKED 1D from Arabidopsis with 39.45% of identity
• Blastx: Protein NETWORKED 1D from Arabidopsis with 37.85% of identity
• Eggnog: NA(ENOG410XW3C)
• Kegg: Link to kegg annotations (AT1G03080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427067.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;