Protein coding transcript 93607

• Transcript: Ll_transcript_377178
• CDS coordinates: 71-688 (+)
• Peptide sequence: MVEEFYRAYRALAERYDNATAVIRHAHRTMSEAFPNQIPMMDENEAEPHTPDAHHPSRAFLETDELTMDASTHFPSTKRNGAHTEGPYSDINKTGLKQLNDLVIPGEHVNVVKFAGGHARRGLNFLGTQEETNGINNESHDSRNQVLSESERVKKAETEIMALKEALVKLESEKEDGLLQYQQSLERLSNLESEVSHAREKYQGLD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_377178

• Blastp: Protein NETWORKED 1D from Arabidopsis with 46.95% of identity
• Blastx: Protein NETWORKED 1D from Arabidopsis with 51.69% of identity
• Eggnog: NA(ENOG410XW3C)
• Kegg: Link to kegg annotations (AT1G03080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427067.1)
• Pfam: KIP1-like protein (PF07765.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;