Protein coding transcript 93611

• Transcript: Ll_transcript_379406
• CDS coordinates: 127-714 (+)
• Peptide sequence: MASRPVVPIHQQQVRGEGVIGGGKQKKNVAADGKNRRALGDIGNLDRVKGVEVKPNRPITRSFCAQLLANAQVAAAVENNKKLAIPNVGGAKPNVVEGAVAKRVAPKPAEKKVVEKPKPREAVEISPHEEVQKNKSVVKKKEGGENKKKPQTLSSVLTARSKVDFEEKKPFHVFDLNHVVLLCLLAYKFMLCSIAG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_379406

• Blastp: G2/mitotic-specific cyclin S13-6 from Soja with 61.08% of identity
• Blastx: G2/mitotic-specific cyclin S13-6 from Soja with 68.48% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (547920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458929.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;